PDB entry 6ge9

View 6ge9 on RCSB PDB site
Description: Structure of Mycobacterium tuberculosis GlmU bound to Glc-1P and Ac-CoA
Class: transferase
Keywords: GlmU, Glc-1P, Ac-CoA, TRANSFERASE
Deposited on 2018-04-25, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) [TaxId:419947]
    Gene: glmU, MRA_1026
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ge9a1, d6ge9a2
  • Heterogens: MG, G1P, ACO, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ge9A (A:)
    mtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdh
    qriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtpllda
    dtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirev
    nagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnn
    rvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqigg
    rcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafve
    vknstigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrtgsdtmf
    vapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqaskrasem
    acqqptqppdadqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ge9A (A:)
    gdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqria
    plvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtla
    dliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagv
    yafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvql
    aelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvv
    gpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafvevkns
    tigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrtgsdtmfvapv
    tigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqaskrase