Lineage for d6ge9a1 (6ge9 A:5-263)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2474233Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2474234Protein automated matches [190951] (28 species)
    not a true protein
  7. 2474321Species Mycobacterium tuberculosis [TaxId:419947] [225670] (2 PDB entries)
  8. 3051603Domain d6ge9a1: 6ge9 A:5-263 [351665]
    Other proteins in same PDB: d6ge9a2
    automated match to d3d8va1
    complexed with aco, edo, g1p, mg, peg

Details for d6ge9a1

PDB Entry: 6ge9 (more details), 2.26 Å

PDB Description: structure of mycobacterium tuberculosis glmu bound to glc-1p and ac- coa
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d6ge9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ge9a1 c.68.1.0 (A:5-263) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
gdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqria
plvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtla
dliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagv
yafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvql
aelaselnrrvvaahqlag

SCOPe Domain Coordinates for d6ge9a1:

Click to download the PDB-style file with coordinates for d6ge9a1.
(The format of our PDB-style files is described here.)

Timeline for d6ge9a1:

  • d6ge9a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-03

View in 3D
Domains from same chain:
(mouse over for more information)
d6ge9a2