Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein automated matches [190608] (4 species) not a true protein |
Species European mistletoe (Viscum album) [TaxId:3972] [225471] (7 PDB entries) |
Domain d6elyb1: 6ely B:1-137 [351656] Other proteins in same PDB: d6elya_ automated match to d1sz6b1 complexed with bfw, cl, gla, gly, gol, nag, so4 |
PDB Entry: 6ely (more details), 2.84 Å
SCOPe Domain Sequences for d6elyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6elyb1 b.42.2.1 (B:1-137) automated matches {European mistletoe (Viscum album) [TaxId: 3972]} ddvtcsaseptvrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt vqtldytlgqgwlagnd
Timeline for d6elyb1: