SCOPe 2.08: Domain d6elyb1: 6ely B:1-137

Lineage for d6elyb1 (6ely B:1-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (4 species)
   not a true protein

7. Species European mistletoe (Viscum album) [TaxId:3972] [225471] (7 PDB entries)

8. Domain d6elyb1: 6ely B:1-137 [351656]
   Other proteins in same PDB: d6elya_
   automated match to d1sz6b1
   complexed with bfw, cl, gly, gol, nag, so4

Details for d6elyb1

PDB Entry: 6ely, 2.84 Å

PDB Description: crystal structure of mistletoe lectin i (ml-i) from viscum album in complex with 4-n-furfurylcytosine at 2.84 a resolution

PDB Compounds: (B:) mistletoe lectin I

SCOPe Domain Sequences for d6elyb1:

Sequence; same for both SEQRES and ATOM records:

>d6elyb1 b.42.2.1 (B:1-137) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
ddvtcsaseptvrivgrngmtvdvrdddfqdgnqiqlwpsksnndpnqlwtikkdgtirs
ngsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttlt
vqtldytlgqgwlagnd

Timeline for d6elyb1:

• d6elyb1 first appeared in SCOPe 2.07