Lineage for d6fmjb1 (6fmj B:17-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945654Domain d6fmjb1: 6fmj B:17-112 [350881]
    Other proteins in same PDB: d6fmja_, d6fmjb2, d6fmjc_, d6fmjd_, d6fmje2, d6fmjf_, d6fmjg_, d6fmjh2, d6fmji_, d6fmjj_, d6fmjk2, d6fmjl_
    automated match to d1lm8c_
    complexed with dv5

Details for d6fmjb1

PDB Entry: 6fmj (more details), 2.45 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- acetamidopropanethioyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl) benzyl)pyrrolidine-2-carboxamide (ligand 3)
PDB Compounds: (B:) Elongin-C

SCOPe Domain Sequences for d6fmjb1:

Sequence, based on SEQRES records: (download)

>d6fmjb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d6fmjb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6fmjb1:

Click to download the PDB-style file with coordinates for d6fmjb1.
(The format of our PDB-style files is described here.)

Timeline for d6fmjb1: