| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Elongin C [54699] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
| Domain d6fmjb1: 6fmj B:17-112 [350881] Other proteins in same PDB: d6fmja_, d6fmjb2, d6fmjc_, d6fmjd_, d6fmje2, d6fmjf_, d6fmjg_, d6fmjh2, d6fmji_, d6fmjj_, d6fmjk2, d6fmjl_ automated match to d1lm8c_ complexed with dv5 |
PDB Entry: 6fmj (more details), 2.45 Å
SCOPe Domain Sequences for d6fmjb1:
Sequence, based on SEQRES records: (download)
>d6fmjb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
>d6fmjb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc
Timeline for d6fmjb1: