Lineage for d6fmjg_ (6fmj G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931335Domain d6fmjg_: 6fmj G: [350876]
    Other proteins in same PDB: d6fmjb1, d6fmjb2, d6fmjc_, d6fmje1, d6fmje2, d6fmjf_, d6fmjh1, d6fmjh2, d6fmji_, d6fmjk1, d6fmjk2, d6fmjl_
    automated match to d1lqba_
    complexed with dv5

Details for d6fmjg_

PDB Entry: 6fmj (more details), 2.45 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- acetamidopropanethioyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl) benzyl)pyrrolidine-2-carboxamide (ligand 3)
PDB Compounds: (G:) Elongin-B

SCOPe Domain Sequences for d6fmjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmjg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d6fmjg_:

Click to download the PDB-style file with coordinates for d6fmjg_.
(The format of our PDB-style files is described here.)

Timeline for d6fmjg_: