Lineage for d6fmja_ (6fmj A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Elongin B [54246] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. Domain d6fmja_: 6fmj A: [350869]
    Other proteins in same PDB: d6fmjb1, d6fmjb2, d6fmjc_, d6fmje1, d6fmje2, d6fmjf_, d6fmjh1, d6fmjh2, d6fmji_, d6fmjk1, d6fmjk2, d6fmjl_
    automated match to d1lqba_
    complexed with dv5

Details for d6fmja_

PDB Entry: 6fmj (more details), 2.4499999999999997 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- acetamidopropanethioyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl) benzyl)pyrrolidine-2-carboxamide (ligand 3)
PDB Compounds: (A:) Elongin-B

SCOPe Domain Sequences for d6fmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmja_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d6fmja_ are not available.

Timeline for d6fmja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6fmjb1, d6fmjb2, d6fmjc_, d6fmjd_, d6fmje1, d6fmje2, d6fmjf_, d6fmjg_, d6fmjh1, d6fmjh2, d6fmji_, d6fmjj_, d6fmjk1, d6fmjk2, d6fmjl_