Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenases [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudodyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenases [53659] (2 families) |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins) the active site is between the two identical subunits |
Protein Isocitrate dehydrogenase, ICDH [53668] (2 species) |
Species Escherichia coli [TaxId:562] [53669] (23 PDB entries) |
Domain d1ika__: 1ika - [35085] complexed with akg, ca |
PDB Entry: 1ika (more details), 2.7 Å
SCOP Domain Sequences for d1ika__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ika__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli} skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
Timeline for d1ika__: