SCOP 1.63: Domain d1ika__: 1ika -

Lineage for d1ika__ (1ika -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenases [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudodyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenases [53659] (2 families)

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)

7. Species Escherichia coli [TaxId:562] [53669] (23 PDB entries)

8. Domain d1ika__: 1ika - [35085]
   complexed with akg, ca

Details for d1ika__

PDB Entry: 1ika, 2.7 Å

PDB Description: structure of isocitrate dehydrogenase with alpha-ketoglutarate at 2.7 angstroms resolution: conformational changes induced by decarboxylation of isocitrate

SCOP Domain Sequences for d1ika__:

Sequence; same for both SEQRES and ATOM records:

>d1ika__ c.77.1.1 (-) Isocitrate dehydrogenase, ICDH {Escherichia coli}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

Timeline for d1ika__:

• d1ika__ first appeared (with stable ids) in SCOP 1.55
  
• d1ika__ appears in SCOP 1.61
  
• d1ika__ appears in SCOP 1.65
  
• d1ika__ appears in the current release, SCOPe 2.08, called d1ikaa_