SCOPe 2.08: Domain d6ax8a2: 6ax8 A:352-509

Lineage for d6ax8a2 (6ax8 A:352-509)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [350821] (1 PDB entry)

8. Domain d6ax8a2: 6ax8 A:352-509 [350822]
   Other proteins in same PDB: d6ax8a1
   automated match to d2x1la2
   protein/RNA complex; complexed with me8

Details for d6ax8a2

PDB Entry: 6ax8, 2.6 Å

PDB Description: mycobacterium tuberculosis methionyl-trna synthetase in complex with methionyl-adenylate

PDB Compounds: (A:) Methionine-tRNA ligase

SCOPe Domain Sequences for d6ax8a2:

Sequence; same for both SEQRES and ATOM records:

>d6ax8a2 a.27.1.0 (A:352-509) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
anelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlal
eaiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesa
gkildllgqapnqrsfaavgvrltpgtalppptgvfpr

Timeline for d6ax8a2:

• d6ax8a2 first appeared in SCOPe 2.07