Lineage for d6ax8a2 (6ax8 A:352-509)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316215Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2316216Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2316269Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2316270Protein automated matches [226872] (13 species)
    not a true protein
  7. 3050759Species Mycobacterium tuberculosis [TaxId:83332] [350821] (1 PDB entry)
  8. 3050760Domain d6ax8a2: 6ax8 A:352-509 [350822]
    Other proteins in same PDB: d6ax8a1
    automated match to d2x1la2
    protein/RNA complex; complexed with me8

Details for d6ax8a2

PDB Entry: 6ax8 (more details), 2.6 Å

PDB Description: mycobacterium tuberculosis methionyl-trna synthetase in complex with methionyl-adenylate
PDB Compounds: (A:) Methionine-tRNA ligase

SCOPe Domain Sequences for d6ax8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ax8a2 a.27.1.0 (A:352-509) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
anelgnlaqrslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlal
eaiwlmlgdankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesa
gkildllgqapnqrsfaavgvrltpgtalppptgvfpr

SCOPe Domain Coordinates for d6ax8a2:

Click to download the PDB-style file with coordinates for d6ax8a2.
(The format of our PDB-style files is described here.)

Timeline for d6ax8a2:

  • d6ax8a2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6ax8a1