PDB entry 6ax8

View 6ax8 on RCSB PDB site
Description: Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with methionyl-adenylate
Class: ligase
Keywords: synthetase, ligase, Ligase-aminoacyl adenylate complex
Deposited on 2017-09-06, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine-tRNA ligase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: metG, metS, Rv1007c, MTCI237.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ax8a1, d6ax8a2
  • Heterogens: ME8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ax8A (A:)
    mkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehglkvaqaaa
    aagvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldn
    ysgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhan
    pdfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgag
    fpdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrgekm
    sksvgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdlanelgnlaq
    rslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlaleaiwlmlgd
    ankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesagkildllgq
    apnqrsfaavgvrltpgtalppptgvfpryqppqppegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ax8A (A:)
    mkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehglkvaqaaa
    aagvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldn
    ysgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhan
    pdfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgag
    fpdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrgekm
    sksvgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdlanelgnlaq
    rslsmvaknldgrvpnpgefadadaallatadgllervrghfdaqamhlaleaiwlmlgd
    ankyfsvqqpwvlrkseseadqarfrttlyvtcevvriaalliqpvmpesagkildllgq
    apnqrsfaavgvrltpgtalppptgvfpr