Lineage for d3icda_ (3icd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905855Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 2905859Species Escherichia coli [TaxId:562] [53669] (27 PDB entries)
  8. 2905875Domain d3icda_: 3icd A: [35078]
    has additional insertions and/or extensions that are not grouped together

Details for d3icda_

PDB Entry: 3icd (more details), 2.5 Å

PDB Description: structure of a bacterial enzyme regulated by phosphorylation, isocitrate dehydrogenase
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d3icda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3icda_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOPe Domain Coordinates for d3icda_:

Click to download the PDB-style file with coordinates for d3icda_.
(The format of our PDB-style files is described here.)

Timeline for d3icda_: