Lineage for d7icda_ (7icd A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1182016Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1182017Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1182018Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1182075Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 1182079Species Escherichia coli [TaxId:562] [53669] (26 PDB entries)
  8. 1182090Domain d7icda_: 7icd A: [35072]

Details for d7icda_

PDB Entry: 7icd (more details), 2.4 Å

PDB Description: regulation of an enzyme by phosphorylation at the active site
PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d7icda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7icda_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]}
skvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykgerk
iswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirelnvalrqel
dlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflree
mgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegafk
dwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviacm
nlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsaem
mlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOPe Domain Coordinates for d7icda_:

Click to download the PDB-style file with coordinates for d7icda_.
(The format of our PDB-style files is described here.)

Timeline for d7icda_: