Lineage for d1a05b_ (1a05 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619978Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1619979Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1619980Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1619981Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)
  7. 1620036Species Thiobacillus ferrooxidans [TaxId:920] [53665] (1 PDB entry)
  8. 1620038Domain d1a05b_: 1a05 B: [35060]
    complexed with ipm, mg

Details for d1a05b_

PDB Entry: 1a05 (more details), 2 Å

PDB Description: crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate
PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1a05b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a05b_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]}
mkkiaifagdgigpeivaaarqvldavdqaahlglrcteglvggaaldasddplpaaslq
lamaadavilgavggprwdayppakrpeqgllrlrkgldlyanlrpaqifpqlldasplr
pelvrdvdilvvreltgdiyfgqprglevidgkrrgfntmvydedeirriahvafraaqg
rrkqlcsvdkanvlettrlwrevvtevardypdvrlshmyvdnaamqlirapaqfdvllt
gnmfgdilsdeasqltgsigmlpsaslgegramyepihgsapdiagqdkanplatilsva
mmlrhslnaepwaqrveaavqrvldqglrtadiaapgtpvigtkamgaavvnalnlk

SCOPe Domain Coordinates for d1a05b_:

Click to download the PDB-style file with coordinates for d1a05b_.
(The format of our PDB-style files is described here.)

Timeline for d1a05b_: