Lineage for d1a05b_ (1a05 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27255Fold c.77: Isocitrate & isopropylmalate dehydrogenases [53658] (1 superfamily)
  4. 27256Superfamily c.77.1: Isocitrate & isopropylmalate dehydrogenases [53659] (1 family) (S)
  5. 27257Family c.77.1.1: Isocitrate & isopropylmalate dehydrogenases [53660] (2 proteins)
  6. 27258Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)
  7. 27294Species Thiobacillus ferrooxidans [TaxId:920] [53665] (1 PDB entry)
  8. 27296Domain d1a05b_: 1a05 B: [35060]

Details for d1a05b_

PDB Entry: 1a05 (more details), 2 Å

PDB Description: crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate

SCOP Domain Sequences for d1a05b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a05b_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans}
mkkiaifagdgigpeivaaarqvldavdqaahlglrcteglvggaaldasddplpaaslq
lamaadavilgavggprwdayppakrpeqgllrlrkgldlyanlrpaqifpqlldasplr
pelvrdvdilvvreltgdiyfgqprglevidgkrrgfntmvydedeirriahvafraaqg
rrkqlcsvdkanvlettrlwrevvtevardypdvrlshmyvdnaamqlirapaqfdvllt
gnmfgdilsdeasqltgsigmlpsaslgegramyepihgsapdiagqdkanplatilsva
mmlrhslnaepwaqrveaavqrvldqglrtadiaapgtpvigtkamgaavvnalnlk

SCOP Domain Coordinates for d1a05b_:

Click to download the PDB-style file with coordinates for d1a05b_.
(The format of our PDB-style files is described here.)

Timeline for d1a05b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a05a_