SCOP 1.67: Domain d1a05b_: 1a05 B:

Lineage for d1a05b_ (1a05 B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (6 species)

7. Species Thiobacillus ferrooxidans [TaxId:920] [53665] (1 PDB entry)

8. Domain d1a05b_: 1a05 B: [35060]
   complexed with ipm, mg

Details for d1a05b_

PDB Entry: 1a05, 2 Å

PDB Description: crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate

SCOP Domain Sequences for d1a05b_:

Sequence; same for both SEQRES and ATOM records:

>d1a05b_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans}
mkkiaifagdgigpeivaaarqvldavdqaahlglrcteglvggaaldasddplpaaslq
lamaadavilgavggprwdayppakrpeqgllrlrkgldlyanlrpaqifpqlldasplr
pelvrdvdilvvreltgdiyfgqprglevidgkrrgfntmvydedeirriahvafraaqg
rrkqlcsvdkanvlettrlwrevvtevardypdvrlshmyvdnaamqlirapaqfdvllt
gnmfgdilsdeasqltgsigmlpsaslgegramyepihgsapdiagqdkanplatilsva
mmlrhslnaepwaqrveaavqrvldqglrtadiaapgtpvigtkamgaavvnalnlk

Timeline for d1a05b_:

• d1a05b_ first appeared (with stable ids) in SCOP 1.55
  
• d1a05b_ appears in SCOP 1.65
  
• d1a05b_ appears in SCOP 1.69
  
• d1a05b_ appears in the current release, SCOPe 2.08