SCOPe 2.08: Domain d6f0ea1: 6f0e A:4-96

Lineage for d6f0ea1 (6f0e A:4-96)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families)

5. Family a.5.3.0: automated matches [227224] (1 protein)
   not a true family

6. Protein automated matches [226965] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [350494] (2 PDB entries)

8. Domain d6f0ea1: 6f0e A:4-96 [350495]
   Other proteins in same PDB: d6f0ea2
   automated match to d1auaa1
   complexed with c8k

Details for d6f0ea1

PDB Entry: 6f0e, 2.6 Å

PDB Description: structure of yeast sec14p with a picolinamide compound

PDB Compounds: (A:) SEC14 cytosolic factor

SCOPe Domain Sequences for d6f0ea1:

Sequence; same for both SEQRES and ATOM records:

>d6f0ea1 a.5.3.0 (A:4-96) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr
arkfdvqlakemfencekwrkdygtdtilqdfh

Timeline for d6f0ea1:

• d6f0ea1 first appeared in SCOPe 2.07