SCOPe 2.08: Domain d6f2cb1: 6f2c B:1-120

Lineage for d6f2cb1 (6f2c B:1-120)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.0: automated matches [347767] (1 protein)
   not a true family

6. Protein automated matches [347768] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [350415] (1 PDB entry)

8. Domain d6f2cb1: 6f2c B:1-120 [350465]
   Other proteins in same PDB: d6f2ca2, d6f2cb2, d6f2cc2, d6f2cd2, d6f2ce2, d6f2cf2, d6f2cg2, d6f2ch2, d6f2ci2, d6f2cj2, d6f2ck2, d6f2cl2
   automated match to d1wo8b_
   complexed with cl, gol

Details for d6f2cb1

PDB Entry: 6f2c, 2.34 Å

PDB Description: methylglyoxal synthase mgsa from bacillus subtilis

PDB Compounds: (B:) methylglyoxal synthase

SCOPe Domain Sequences for d6f2cb1:

Sequence; same for both SEQRES and ATOM records:

>d6f2cb1 c.24.1.0 (B:1-120) automated matches {Bacillus subtilis [TaxId: 224308]}
mkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplggd
qqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrtld

Timeline for d6f2cb1:

• d6f2cb1 first appeared in SCOPe 2.07