Lineage for d6f2cf1 (6f2c F:1-120)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859693Family c.24.1.0: automated matches [347767] (1 protein)
    not a true family
  6. 2859694Protein automated matches [347768] (3 species)
    not a true protein
  7. 2859695Species Bacillus subtilis [TaxId:224308] [350415] (1 PDB entry)
  8. 2859701Domain d6f2cf1: 6f2c F:1-120 [350459]
    Other proteins in same PDB: d6f2ca2, d6f2cb2, d6f2cc2, d6f2cd2, d6f2ce2, d6f2cf2, d6f2cg2, d6f2ch2, d6f2ci2, d6f2cj2, d6f2ck2, d6f2cl2
    automated match to d1wo8b_
    complexed with cl, gol

Details for d6f2cf1

PDB Entry: 6f2c (more details), 2.34 Å

PDB Description: methylglyoxal synthase mgsa from bacillus subtilis
PDB Compounds: (F:) methylglyoxal synthase

SCOPe Domain Sequences for d6f2cf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f2cf1 c.24.1.0 (F:1-120) automated matches {Bacillus subtilis [TaxId: 224308]}
mkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplggd
qqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrtld

SCOPe Domain Coordinates for d6f2cf1:

Click to download the PDB-style file with coordinates for d6f2cf1.
(The format of our PDB-style files is described here.)

Timeline for d6f2cf1: