Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) contains a common phosphate-binding site |
Family c.24.1.0: automated matches [347767] (1 protein) not a true family |
Protein automated matches [347768] (3 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [350415] (1 PDB entry) |
Domain d6f2cf1: 6f2c F:1-120 [350459] Other proteins in same PDB: d6f2ca2, d6f2cb2, d6f2cc2, d6f2cd2, d6f2ce2, d6f2cf2, d6f2cg2, d6f2ch2, d6f2ci2, d6f2cj2, d6f2ck2, d6f2cl2 automated match to d1wo8b_ complexed with cl, gol |
PDB Entry: 6f2c (more details), 2.34 Å
SCOPe Domain Sequences for d6f2cf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f2cf1 c.24.1.0 (F:1-120) automated matches {Bacillus subtilis [TaxId: 224308]} mkialiahdkkkqdmvqfttayrdilknhdlyatgttglkiheatglqierfqsgplggd qqigaliaanaldlviflrdpltaqphepdvsalirlcdvysiplatnmgtaeilvrtld
Timeline for d6f2cf1: