| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily) dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices |
Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) ![]() |
| Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins) Pfam PF03271 |
| Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [350342] (2 PDB entries) |
| Domain d6evqb_: 6evq B: [350353] automated match to d1wu9b_ complexed with c05 |
PDB Entry: 6evq (more details)
SCOPe Domain Sequences for d6evqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6evqb_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
deaaelmqqvkvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
egfvipdegg
Timeline for d6evqb_: