PDB entry 6evq

View 6evq on RCSB PDB site
Description: solution NMR structure of EB1 C terminus (191-260) with a small molecule bound into the SxIP binding site
Class: protein binding
Keywords: End-binding protein, EB1, microtubules, SxIP, Microtubule-associated protein RP/EB family member 1, MAPRE1, APC-binding protein EB1, PROTEIN BINDING
Deposited on 2017-11-02, released 2018-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Microtubule-associated protein RP/EB family member 1
  Species: Mus musculus [TaxId:10090]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q61166 (0-69)
  Domains in SCOPe 2.08: d6evqa_
• Chain 'B':
  Compound: Microtubule-associated protein RP/EB family member 1
  Species: Mus musculus [TaxId:10090]
  Gene: MAPRE1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q61166 (0-69)
  Domains in SCOPe 2.08: d6evqb_
• Heterogens: C05

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6evqA (A:)
  deaaelmqqvkvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
  egfvipdegg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6evqB (B:)
  deaaelmqqvkvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
  egfvipdegg