SCOPe 2.07: Domain d6ciga2: 6cig A:109-352

Lineage for d6ciga2 (6cig A:109-352)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
   automatically mapped to Pfam PF00891

6. Protein Isoflavone O-methyltransferase [64114] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [64115] (3 PDB entries)

8. Domain d6ciga2: 6cig A:109-352 [350141]
   Other proteins in same PDB: d6ciga1
   automated match to d1fp2a2
   complexed with gol, pg4, sah, so4, t3a

Details for d6ciga2

PDB Entry: 6cig, 1.65 Å

PDB Description: crystal structure analysis of selenomethionine substituted isoflavone o-methyltransferase

PDB Compounds: (A:) Isoflavone-7-O-methyltransferase 8

SCOPe Domain Sequences for d6ciga2:

Sequence; same for both SEQRES and ATOM records:

>d6ciga2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
lclapmvecvldptlsgsyhelkkwiyeedltlfgvtlgsgfwdfldknpeyntsfndam
asdsklinlalrdcdfvfdglesivdvgggtgttakiicetfpklkcivfdrpqvvenls
gsnnltyvggdmftsipnadavllkyilhnwtdkdclrilkkckeavtndgkrgkvtiid
mvidkkkdenqvtqikllmdvnmaclngkerneeewkklfieagfqhykispltgflsli
eiyp

Timeline for d6ciga2:

• d6ciga2 is new in SCOPe 2.07-stable
  
• d6ciga2 appears in the current release, SCOPe 2.08