Lineage for d6ciga1 (6cig A:4-108)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307264Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
    unknown function
  6. 2307300Protein Isoflavone O-methyltransferase [63478] (1 species)
  7. 2307301Species Alfalfa (Medicago sativa) [TaxId:3879] [63479] (3 PDB entries)
  8. 2307304Domain d6ciga1: 6cig A:4-108 [350140]
    Other proteins in same PDB: d6ciga2
    automated match to d1fp2a1
    complexed with gol, pg4, sah, so4, t3a

Details for d6ciga1

PDB Entry: 6cig (more details), 1.65 Å

PDB Description: crystal structure analysis of selenomethionine substituted isoflavone o-methyltransferase
PDB Compounds: (A:) Isoflavone-7-O-methyltransferase 8

SCOPe Domain Sequences for d6ciga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ciga1 a.4.5.29 (A:4-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
singrkpseifkaqallykhiyafidsmslkwavemnipniiqnhgkpislsnlvsilqv
psskignvrrlmrylahngffeiitkeeesyaltvasellvrgsd

SCOPe Domain Coordinates for d6ciga1:

Click to download the PDB-style file with coordinates for d6ciga1.
(The format of our PDB-style files is described here.)

Timeline for d6ciga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ciga2