Lineage for d6c8qb_ (6c8q B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469806Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2469807Protein automated matches [190116] (28 species)
    not a true protein
  7. 2469844Species Enterococcus faecalis [TaxId:226185] [349998] (1 PDB entry)
  8. 2469846Domain d6c8qb_: 6c8q B: [349999]
    automated match to d4q16a_
    complexed with nad

Details for d6c8qb_

PDB Entry: 6c8q (more details), 2.58 Å

PDB Description: crystal structure of nad synthetase (nade) from enterococcus faecalis in complex with nad+
PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d6c8qb_:

Sequence, based on SEQRES records: (download)

>d6c8qb_ c.26.2.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mttlqekiiqelgvlptidpkeevrksidflkayltkhpflktfvlgisggqdstlagrl
aqlamtemreetgdmsyqfiairlpygeqadeadaqaalafiqpdvslrvdikpavdamv
gslenagvqisdfnkgnmkarqrmitqyavagenagavigtdhaaenvtafftkygdgga
dilplfrlnkrqgkallkelgapealylkiptadleddkplvadevalgvtydaiddyle
gkkvsetdqqtienwykkgqhkrhlpitifddfwk

Sequence, based on observed residues (ATOM records): (download)

>d6c8qb_ c.26.2.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mttlqekiiqelgvlptidpkeevrksidflkayltkhpflktfvlgisggqdstlagrl
aqlamtemreetgdmsyqfiairlpygeqadeadaqaalafiqpdvslrvdikpavdamv
gslenagvqisdfnkgnmkarqrmitqyavagenagavigtdhaaenvtafftkygdgga
dilplfrlnkrqgkallkelgapealylkkplvadevalgvtydaiddylegkkvsetdq
qtienwykkgqhkrhlpitifddfwk

SCOPe Domain Coordinates for d6c8qb_:

Click to download the PDB-style file with coordinates for d6c8qb_.
(The format of our PDB-style files is described here.)

Timeline for d6c8qb_: