Lineage for d6bt0d1 (6bt0 D:3-169)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867227Protein GTP-binding protein RheB [142275] (2 species)
  7. 2867228Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries)
    Uniprot Q15382 3-169
  8. 2867251Domain d6bt0d1: 6bt0 D:3-169 [349873]
    Other proteins in same PDB: d6bt0a2, d6bt0b2, d6bt0c2, d6bt0d2
    automated match to d3t5ga_
    complexed with e7v, gdp, mg

Details for d6bt0d1

PDB Entry: 6bt0 (more details), 2.6 Å

PDB Description: crystal structure of rheb in complex with compound nr1
PDB Compounds: (D:) GTP-binding protein Rheb

SCOPe Domain Sequences for d6bt0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bt0d1 c.37.1.8 (D:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
qsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdta
gqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkd
lhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

SCOPe Domain Coordinates for d6bt0d1:

Click to download the PDB-style file with coordinates for d6bt0d1.
(The format of our PDB-style files is described here.)

Timeline for d6bt0d1: