Lineage for d4fuaa_ (4fua A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2512903Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2512904Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2512905Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2512906Protein L-fuculose-1-phosphate aldolase [53641] (1 species)
    class II aldolase
  7. 2512907Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)
  8. 2512914Domain d4fuaa_: 4fua A: [34983]
    complexed with bme, pgh, so4, zn

Details for d4fuaa_

PDB Entry: 4fua (more details), 2.43 Å

PDB Description: l-fuculose-1-phosphate aldolase complex with pgh
PDB Compounds: (A:) l-fuculose-1-phosphate aldolase

SCOPe Domain Sequences for d4fuaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fuaa_ c.74.1.1 (A:) L-fuculose-1-phosphate aldolase {Escherichia coli [TaxId: 562]}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf

SCOPe Domain Coordinates for d4fuaa_:

Click to download the PDB-style file with coordinates for d4fuaa_.
(The format of our PDB-style files is described here.)

Timeline for d4fuaa_: