SCOP 1.55: Domain d4fua__: 4fua -

Lineage for d4fua__ (4fua -)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.74: Class II aldolase [53638] (1 superfamily)

4. Superfamily c.74.1: Class II aldolase [53639] (1 family)

5. Family c.74.1.1: Class II aldolase [53640] (1 protein)

6. Protein L-fuculose-1-phosphate aldolase [53641] (1 species)

7. Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)

8. Domain d4fua__: 4fua - [34983]

Details for d4fua__

PDB Entry: 4fua, 2.43 Å

PDB Description: l-fuculose-1-phosphate aldolase complex with pgh

SCOP Domain Sequences for d4fua__:

Sequence; same for both SEQRES and ATOM records:

>d4fua__ c.74.1.1 (-) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf

Timeline for d4fua__:

• d4fua__ appears in SCOP 1.57
  
• d4fua__ appears in the current release, SCOPe 2.08, called d4fuaa_