Lineage for d6bv4a3 (6bv4 A:545-633)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376781Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2376803Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2376804Protein automated matches [254707] (4 species)
    not a true protein
  7. 2376848Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries)
  8. 2376864Domain d6bv4a3: 6bv4 A:545-633 [349791]
    Other proteins in same PDB: d6bv4a1, d6bv4a2, d6bv4a4, d6bv4a5
    automated match to d4fkea3
    complexed with met, nag, so4, zn

Details for d6bv4a3

PDB Entry: 6bv4 (more details), 2.02 Å

PDB Description: crystal structure of porcine aminopeptidase-n with methionine
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6bv4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bv4a3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

SCOPe Domain Coordinates for d6bv4a3:

Click to download the PDB-style file with coordinates for d6bv4a3.
(The format of our PDB-style files is described here.)

Timeline for d6bv4a3: