Lineage for d6bv4a1 (6bv4 A:63-282)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2429865Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2429866Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2429953Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2429954Protein automated matches [254706] (5 species)
    not a true protein
  7. 2430008Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries)
  8. 2430024Domain d6bv4a1: 6bv4 A:63-282 [349789]
    Other proteins in same PDB: d6bv4a2, d6bv4a3, d6bv4a4, d6bv4a5
    automated match to d4fkea1
    complexed with met, nag, so4, zn

Details for d6bv4a1

PDB Entry: 6bv4 (more details), 2.02 Å

PDB Description: crystal structure of porcine aminopeptidase-n with methionine
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6bv4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bv4a1 b.98.1.0 (A:63-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
nmppkgsstplaedpnwsvtefettpvmstyllayivsef

SCOPe Domain Coordinates for d6bv4a1:

Click to download the PDB-style file with coordinates for d6bv4a1.
(The format of our PDB-style files is described here.)

Timeline for d6bv4a1: