SCOPe 2.07: Domain d6bv4a1: 6bv4 A:63-282

Lineage for d6bv4a1 (6bv4 A:63-282)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries)

8. Domain d6bv4a1: 6bv4 A:63-282 [349789]
   Other proteins in same PDB: d6bv4a2, d6bv4a3, d6bv4a4, d6bv4a5
   automated match to d4fkea1
   complexed with met, nag, so4, zn

Details for d6bv4a1

PDB Entry: 6bv4, 2.02 Å

PDB Description: crystal structure of porcine aminopeptidase-n with methionine

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6bv4a1:

Sequence; same for both SEQRES and ATOM records:

>d6bv4a1 b.98.1.0 (A:63-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
nmppkgsstplaedpnwsvtefettpvmstyllayivsef

Timeline for d6bv4a1:

• d6bv4a1 is new in SCOPe 2.07-stable
  
• d6bv4a1 appears in the current release, SCOPe 2.08