Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Serratia marcescens [TaxId:615] [349781] (1 PDB entry) |
Domain d6bvca_: 6bvc A: [349782] automated match to d4yfjb_ complexed with cl, coa, gol, pe3 |
PDB Entry: 6bvc (more details), 1.81 Å
SCOPe Domain Sequences for d6bvca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bvca_ d.108.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]} mgiirtcrlgpdqvksmraaldlfgrefgdvatysqhqpdsdylgnllrsktfialaafd qeavvgalaayvlpkfeqprseiyiydlavsgehrrqgiatalinllkheanalgayviy vqadygddpavalytklgireevmhfdidpstat
Timeline for d6bvca_: