Lineage for d6bvca_ (6bvc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969421Species Serratia marcescens [TaxId:615] [349781] (1 PDB entry)
  8. 2969422Domain d6bvca_: 6bvc A: [349782]
    automated match to d4yfjb_
    complexed with cl, coa, gol, pe3

Details for d6bvca_

PDB Entry: 6bvc (more details), 1.81 Å

PDB Description: crystal structure of aac(3)-ia in complex with coenzyme a
PDB Compounds: (A:) Aminoglycoside-(3)-N-acetyltransferase

SCOPe Domain Sequences for d6bvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bvca_ d.108.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
mgiirtcrlgpdqvksmraaldlfgrefgdvatysqhqpdsdylgnllrsktfialaafd
qeavvgalaayvlpkfeqprseiyiydlavsgehrrqgiatalinllkheanalgayviy
vqadygddpavalytklgireevmhfdidpstat

SCOPe Domain Coordinates for d6bvca_:

Click to download the PDB-style file with coordinates for d6bvca_.
(The format of our PDB-style files is described here.)

Timeline for d6bvca_: