Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (25 species) not a true protein |
Species Rhizobium leguminosarum [TaxId:216596] [346484] (5 PDB entries) |
Domain d6azqb_: 6azq B: [349553] automated match to d3irva_ complexed with c5j, ca |
PDB Entry: 6azq (more details), 2.22 Å
SCOPe Domain Sequences for d6azqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6azqb_ c.33.1.0 (B:) automated matches {Rhizobium leguminosarum [TaxId: 216596]} nrhfidadpypwpyngalrpdntaliiidmqtdfcgkggyvdhmgydlslvqapiepikr vlaamrakgyhiihtreghrpdladlpankrwrsqrigagigdpgpcgriltrgepgwdi ipelypiegetiidkpgkgsfcatdlelvlnqkrieniiltgittdvsvsttmreandrg yecllledccgatdygnhlaaikmvkmqggvfgsvsnsaalvealp
Timeline for d6azqb_: