Lineage for d6azqf_ (6azq F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472415Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2472416Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2472469Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2472470Protein automated matches [190499] (25 species)
    not a true protein
  7. 2472556Species Rhizobium leguminosarum [TaxId:216596] [346484] (5 PDB entries)
  8. 2472578Domain d6azqf_: 6azq F: [349329]
    automated match to d3irva_
    complexed with c5j, ca

Details for d6azqf_

PDB Entry: 6azq (more details), 2.22 Å

PDB Description: structural and biochemical characterization of a non-canonical biuret hydrolase (biuh) from the cyanuric acid catabolism pathway of rhizobium leguminasorum bv. viciae 3841
PDB Compounds: (F:) Putative amidase

SCOPe Domain Sequences for d6azqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6azqf_ c.33.1.0 (F:) automated matches {Rhizobium leguminosarum [TaxId: 216596]}
rhfidadpypwpyngalrpdntaliiidmqtdfcgkggyvdhmgydlslvqapiepikrv
laamrakgyhiihtreghrpdladlpankrwrsqrigagigdpgpcgriltrgepgwdii
pelypiegetiidkpgkgsfcatdlelvlnqkrieniiltgittdvsvsttmreandrgy
ecllledccgatdygnhlaaikmvkmqggvfgsvsnsaalvealp

SCOPe Domain Coordinates for d6azqf_:

Click to download the PDB-style file with coordinates for d6azqf_.
(The format of our PDB-style files is described here.)

Timeline for d6azqf_: