Lineage for d5z2ll1 (5z2l L:2-237)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455220Species Escherichia coli [TaxId:83333] [349042] (4 PDB entries)
  8. 2455244Domain d5z2ll1: 5z2l L:2-237 [349490]
    Other proteins in same PDB: d5z2la2, d5z2lb2, d5z2lc2, d5z2ld2, d5z2le2, d5z2lf2, d5z2lg2, d5z2lh2, d5z2li2, d5z2lj2, d5z2lk2, d5z2ll2
    automated match to d4rlhb_
    complexed with edo, gol, ndp, peg, pg0, pg4

Details for d5z2ll1

PDB Entry: 5z2l (more details), 1.7 Å

PDB Description: crystal structure of bdca in complex with nadph
PDB Compounds: (L:) Cyclic-di-GMP-binding biofilm dispersal mediator protein

SCOPe Domain Sequences for d5z2ll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z2ll1 c.2.1.0 (L:2-237) automated matches {Escherichia coli [TaxId: 83333]}
gaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavftdsa
drdavidvvrksgaldilvvnagigvfgealelnaddidrlfkinihapyhasveaarqm
peggriliigsvngdrmpvagmaayaasksalqgmarglardfgprgitinvvqpgpidt
danpangpmrdmlhslmaikrhgqpeevagmvawlagpeasfvtgamhtidgafga

SCOPe Domain Coordinates for d5z2ll1:

Click to download the PDB-style file with coordinates for d5z2ll1.
(The format of our PDB-style files is described here.)

Timeline for d5z2ll1: