SCOPe 2.07: Structural Classification of Proteins

PDB entry 5z2l

View 5z2l on RCSB PDB site
Description: Crystal structure of BdcA in complex with NADPH
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase (SDR), NADPH binding, biofilm dispersal, OXIDOREDUCTASE
Deposited on 2018-01-03, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-239)
Domains in SCOPe 2.07: d5z2la1, d5z2la2
Chain 'B':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-243)
Domains in SCOPe 2.07: d5z2lb1, d5z2lb2
Chain 'C':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-241)
Domains in SCOPe 2.07: d5z2lc1, d5z2lc2
Chain 'D':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-240)
Domains in SCOPe 2.07: d5z2ld1, d5z2ld2
Chain 'E':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-239)
Domains in SCOPe 2.07: d5z2le1, d5z2le2
Chain 'F':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-239)
Domains in SCOPe 2.07: d5z2lf1, d5z2lf2
Chain 'G':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-239)
Domains in SCOPe 2.07: d5z2lg1, d5z2lg2
Chain 'H':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-239)
Domains in SCOPe 2.07: d5z2lh1, d5z2lh2
Chain 'I':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-241)
Domains in SCOPe 2.07: d5z2li1, d5z2li2
Chain 'J':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-242)
Domains in SCOPe 2.07: d5z2lj1, d5z2lj2
Chain 'K':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-244)
Domains in SCOPe 2.07: d5z2lk1, d5z2lk2
Chain 'L':
Compound: Cyclic-di-GMP-binding biofilm dispersal mediator protein
Species: Escherichia coli (strain K12) [TaxId:83333]
Gene: bdcA, yjgI, b4249, JW4207
Database cross-references and differences (RAF-indexed):
- Uniprot P39333 (Start-236)
  - expression tag (237-239)
Domains in SCOPe 2.07: d5z2ll1, d5z2ll2
Heterogens: NDP, PG0, EDO, GOL, PEG, PG4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5z2lA (A:)
mgaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavftds
adrdavidvvrksgaldilvvnagigvfgealelnaddidrlfkinihapyhasveaarq
mpeggriliigsvngdrmpvagmaayaasksalqgmarglardfgprgitinvvqpgpid
tdanpangpmrdmlhslmaikrhgqpeevagmvawlagpeasfvtgamhtidgafgaleh
hhhhh