![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (5 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins) |
![]() | Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries) |
![]() | Domain d1c3qb_: 1c3q B: [34949] |
PDB Entry: 1c3q (more details), 2 Å
SCOP Domain Sequences for d1c3qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3qb_ c.72.1.2 (B:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis} mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg pgsfqiellnklstvteqdvqewatiervtvs
Timeline for d1c3qb_: