Lineage for d1c3qb_ (1c3q B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591165Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 591166Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 591229Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins)
  6. 591238Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species)
  7. 591241Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)
  8. 591250Domain d1c3qb_: 1c3q B: [34949]

Details for d1c3qb_

PDB Entry: 1c3q (more details), 2 Å

PDB Description: crystal structure of native thiazole kinase in the monoclinic form

SCOP Domain Sequences for d1c3qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3qb_ c.72.1.2 (B:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatiervtvs

SCOP Domain Coordinates for d1c3qb_:

Click to download the PDB-style file with coordinates for d1c3qb_.
(The format of our PDB-style files is described here.)

Timeline for d1c3qb_: