SCOP 1.69: Domain d1c3qc_: 1c3q C:

Lineage for d1c3qc_ (1c3q C:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (5 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins)

6. Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)

8. Domain d1c3qc_: 1c3q C: [34950]

Details for d1c3qc_

PDB Entry: 1c3q, 2 Å

PDB Description: crystal structure of native thiazole kinase in the monoclinic form

SCOP Domain Sequences for d1c3qc_:

Sequence; same for both SEQRES and ATOM records:

>d1c3qc_ c.72.1.2 (C:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatiervtvs

Timeline for d1c3qc_:

• d1c3qc_ first appeared (with stable ids) in SCOP 1.55
  
• d1c3qc_ appears in SCOP 1.67
  
• d1c3qc_ last appears in SCOP 1.71