Lineage for d6atlc1 (6atl C:1-35)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635336Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2635463Protein automated matches [197331] (11 species)
    not a true protein
  7. 2635525Species Tityus serrulatus [TaxId:6887] [349390] (1 PDB entry)
  8. 2635527Domain d6atlc1: 6atl C:1-35 [349391]
    Other proteins in same PDB: d6atla2, d6atlc2
    automated match to d1tska_
    complexed with cit, so4

Details for d6atlc1

PDB Entry: 6atl (more details), 1.8 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox
PDB Compounds: (C:) Potassium channel toxin alpha-KTx 4.2

SCOPe Domain Sequences for d6atlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6atlc1 g.3.7.2 (C:1-35) automated matches {Tityus serrulatus [TaxId: 6887]}
vvigqrcyrspdcysackklvgkatgkctngrcdc

SCOPe Domain Coordinates for d6atlc1:

Click to download the PDB-style file with coordinates for d6atlc1.
(The format of our PDB-style files is described here.)

Timeline for d6atlc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6atlc2