SCOPe 2.08: Domain d6avab1: 6ava B:3-38

Lineage for d6avab1 (6ava B:3-38)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)

6. Protein automated matches [197331] (11 species)
   not a true protein

7. Species Mesobuthus eupeus [TaxId:34648] [349184] (1 PDB entry)

8. Domain d6avab1: 6ava B:3-38 [349185]
   Other proteins in same PDB: d6avaa2, d6avab2
   automated match to d1sisa_

Details for d6avab1

PDB Entry: 6ava, 2.2 Å

PDB Description: exploring cystine dense peptide space to open a unique molecular toolbox

PDB Compounds: (B:) Insectotoxin-I1

SCOPe Domain Sequences for d6avab1:

Sequence; same for both SEQRES and ATOM records:

>d6avab1 g.3.7.2 (B:3-38) automated matches {Mesobuthus eupeus [TaxId: 34648]}
mcmpcfttrpdmaqqcracckgrgkcfgpqclcgyd

Timeline for d6avab1:

• d6avab1 first appeared in SCOPe 2.07