Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) |
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) |
Protein Dihydrofolate reductase, prokaryotic type [53599] (6 species) |
Species Lactobacillus casei [TaxId:1582] [53601] (6 PDB entries) |
Domain d1dis__: 1dis - [34881] complexed with bdm |
PDB Entry: 1dis (more details)
SCOP Domain Sequences for d1dis__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dis__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei} taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka
Timeline for d1dis__: