Lineage for d1dis__ (1dis -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 320020Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 320021Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 320022Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 320031Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species)
  7. 320096Species Lactobacillus casei [TaxId:1582] [53601] (6 PDB entries)
  8. 320098Domain d1dis__: 1dis - [34881]
    complexed with bdm

Details for d1dis__

PDB Entry: 1dis (more details)

PDB Description: dihydrofolate reductase (e.c.1.5.1.3) complex with brodimoprim-4,6- dicarboxylate

SCOP Domain Sequences for d1dis__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dis__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

SCOP Domain Coordinates for d1dis__:

Click to download the PDB-style file with coordinates for d1dis__.
(The format of our PDB-style files is described here.)

Timeline for d1dis__: