Lineage for d1dis__ (1dis -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species) 
Species Lactobacillus casei [TaxId:1582] [53601] (5 PDB entries) 
Domain d1dis__: 1dis - [34881]
Details for d1dis__
PDB Entry: 1dis (more details)
PDB Description: dihydrofolate reductase (e.c.1.5.1.3) complex with brodimoprim-4,6- dicarboxylate
SCOP Domain Sequences for d1dis__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dis__ c.71.1.1 (-) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka
SCOP Domain Coordinates for d1dis__:
Click to download the PDB-style file with coordinates for d1dis__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dis__:
- d1dis__ appears in SCOP 1.57
- d1dis__ appears in the current release, SCOPe 2.08, called d1disa_
View in 3D