Lineage for d5y63d_ (5y63 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879452Species Enterococcus faecalis [TaxId:226185] [348733] (1 PDB entry)
  8. 2879456Domain d5y63d_: 5y63 D: [348734]
    automated match to d5b8ah_

Details for d5y63d_

PDB Entry: 5y63 (more details), 2.87 Å

PDB Description: crystal structure of enterococcus faecalis ahpc
PDB Compounds: (D:) Alkyl hydroperoxide reductase, C subunit

SCOPe Domain Sequences for d5y63d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y63d_ c.47.1.0 (D:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mnlinqklfdfecdayhdgeftrvstedilgkwsifffypadfsfvcptelgdmqehyah
lqelncevysvsedshyvhkawadatetigkikypmladpngqlarffgvldeasgmayr
asfivspegdiksyeindmgigrnaeelvrkleasqfvaehgdkvcp

SCOPe Domain Coordinates for d5y63d_:

Click to download the PDB-style file with coordinates for d5y63d_.
(The format of our PDB-style files is described here.)

Timeline for d5y63d_: