Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [348733] (1 PDB entry) |
Domain d5y63d_: 5y63 D: [348734] automated match to d5b8ah_ |
PDB Entry: 5y63 (more details), 2.87 Å
SCOPe Domain Sequences for d5y63d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y63d_ c.47.1.0 (D:) automated matches {Enterococcus faecalis [TaxId: 226185]} mnlinqklfdfecdayhdgeftrvstedilgkwsifffypadfsfvcptelgdmqehyah lqelncevysvsedshyvhkawadatetigkikypmladpngqlarffgvldeasgmayr asfivspegdiksyeindmgigrnaeelvrkleasqfvaehgdkvcp
Timeline for d5y63d_:
View in 3D Domains from other chains: (mouse over for more information) d5y63a_, d5y63b_, d5y63c_, d5y63e_ |