SCOPe 2.07: Domain d2drcb_: 2drc B:

Lineage for d2drcb_ (2drc B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)

8. Domain d2drcb_: 2drc B: [34849]
   complexed with ca, cl, mtx

Details for d2drcb_

PDB Entry: 2drc, 1.9 Å

PDB Description: investigation of the functional role of tryptophan-22 in escherichia coli dihydrofolate reductase by site-directed mutagenesis

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d2drcb_:

Sequence; same for both SEQRES and ATOM records:

>d2drcb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampfnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d2drcb_:

• d2drcb_ first appeared (with stable ids) in SCOP 1.55
  
• d2drcb_ appears in SCOPe 2.06
  
• d2drcb_ appears in the current release, SCOPe 2.08