Lineage for d2drcb_ (2drc B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) Protein Dihydrofolate reductase, prokaryotic type [53599] (5 species) Species Escherichia coli [TaxId:562] [53600] (42 PDB entries) 
Domain d2drcb_: 2drc B: [34849]
Details for d2drcb_
PDB Entry: 2drc (more details), 1.9 Å
PDB Description: investigation of the functional role of tryptophan-22 in escherichia coli dihydrofolate reductase by site-directed mutagenesis
SCOP Domain Sequences for d2drcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2drcb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli}
misliaalavdrvigmenampfnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
SCOP Domain Coordinates for d2drcb_:
Click to download the PDB-style file with coordinates for d2drcb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2drcb_:
- d2drcb_ appears in SCOP 1.57
- d2drcb_ appears in the current release, SCOPe 2.08
View in 3D
