Lineage for d5we9a1 (5we9 A:1-196)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490599Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2490600Protein PA N-terminal domain [254375] (7 species)
  7. 2490626Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)
  8. 2490641Domain d5we9a1: 5we9 A:1-196 [348407]
    Other proteins in same PDB: d5we9a2
    automated match to d4e5ed_
    complexed with edo, gy7, mg, mn

Details for d5we9a1

PDB Entry: 5we9 (more details), 1.8 Å

PDB Description: crystal structure of the influenza virus pa endonuclease in complex with inhibitor 7b (sri-29731)
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5we9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5we9a1 c.52.1.34 (A:1-196) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser

SCOPe Domain Coordinates for d5we9a1:

Click to download the PDB-style file with coordinates for d5we9a1.
(The format of our PDB-style files is described here.)

Timeline for d5we9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5we9a2