Lineage for d4e5ed_ (4e5e D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490599Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2490600Protein PA N-terminal domain [254375] (7 species)
  7. 2490626Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)
  8. 2490667Domain d4e5ed_: 4e5e D: [251668]
    automated match to d3ebja_
    complexed with mn, so4

Details for d4e5ed_

PDB Entry: 4e5e (more details), 2.05 Å

PDB Description: crystal structure of avian influenza virus pan apo
PDB Compounds: (D:) Polymerase protein PA

SCOPe Domain Sequences for d4e5ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e5ed_ c.52.1.34 (D:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
ela

SCOPe Domain Coordinates for d4e5ed_:

Click to download the PDB-style file with coordinates for d4e5ed_.
(The format of our PDB-style files is described here.)

Timeline for d4e5ed_: