SCOPe 2.08: Domain d1ra9a_: 1ra9 A:

Lineage for d1ra9a_ (1ra9 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)

8. Domain d1ra9a_: 1ra9 A: [34820]
   complexed with nap

Details for d1ra9a_

PDB Entry: 1ra9, 1.55 Å

PDB Description: dihydrofolate reductase complexed with nicotinamide adenine dinucleotide phosphate (oxidized form)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1ra9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ra9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d1ra9a_:

• d1ra9a_ first appeared (with stable ids) in SCOP 1.55, called d1ra9__
  
• d1ra9a_ appears in SCOPe 2.07