Lineage for d1ex9a_ (1ex9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508522Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2508523Protein Lipase [53571] (4 species)
  7. 2508535Species Pseudomonas aeruginosa [TaxId:287] [53575] (1 PDB entry)
  8. 2508536Domain d1ex9a_: 1ex9 A: [34785]
    complexed with ca, ocp

Details for d1ex9a_

PDB Entry: 1ex9 (more details), 2.54 Å

PDB Description: crystal structure of the pseudomonas aeruginosa lipase complexed with rc-(rp,sp)-1,2-dioctylcarbamoyl-glycero-3-o-octylphosphonate
PDB Compounds: (A:) lactonizing lipase

SCOPe Domain Sequences for d1ex9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]}
stytqtkypivlahgmlgfdnilgvdywfgipsalrrdgaqvyvtevsqldtsevrgeql
lqqveeivalsgqpkvnlighshggptiryvaavrpdliasatsvgaphkgsdtadflrq
ippgsageavlsglvnslgalisflssgstgtqnslgsleslnsegaarfnakypqgipt
sacgegaykvngvsyyswsgsspltnfldpsdaflgassltfkngtandglvgtcsshlg
mvirdnyrmnhldevnqvfgltslfetspvsvyrqhanrlknasl

SCOPe Domain Coordinates for d1ex9a_:

Click to download the PDB-style file with coordinates for d1ex9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ex9a_: