Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.18: Bacterial lipase [53570] (3 proteins) lack the first two strands of the common fold |
Protein Lipase [53571] (4 species) |
Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [63399] (7 PDB entries) |
Domain d5lipa_: 5lip A: [34784] complexed with ca, ocp |
PDB Entry: 5lip (more details), 2.9 Å
SCOP Domain Sequences for d5lipa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lipa_ c.69.1.18 (A:) Lipase {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp saglgapgscqtgaptetvggnthllyswagtaiqptisvfgvtgatdtstiplvdpana ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan aedpvavirthanrlklagv
Timeline for d5lipa_: