Lineage for d1oilb_ (1oil B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508522Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2508523Protein Lipase [53571] (4 species)
  7. 2508524Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [63399] (6 PDB entries)
  8. 2508531Domain d1oilb_: 1oil B: [34781]
    complexed with ca

Details for d1oilb_

PDB Entry: 1oil (more details), 2.1 Å

PDB Description: structure of lipase
PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d1oilb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oilb_ c.69.1.18 (B:) Lipase {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng
rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp
saglgapgscqtgaptetvggnthllyswagtaiqptisvfgvtgatdtstiplvdpana
ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan
aedpvavirthanrlklagv

SCOPe Domain Coordinates for d1oilb_:

Click to download the PDB-style file with coordinates for d1oilb_.
(The format of our PDB-style files is described here.)

Timeline for d1oilb_: